FAM183B (FAM183BP) Rabbit Polyclonal Antibody TA335910 from OriGene Technologies | Biocompare.com

Supplier Images

FAM183B (FAM183BP) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM183B (FAM183BP) Rabbit Polyclonal Antibody

OriGene Technologies' FAM183B (FAM183BP) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The FAM183B (FAM183BP) Rabbit Polyclonal Antibody was generated using FAM183BP, and family with sequence similarity 183 member B, pseudogene as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-FAM183B Antibody

Product Specs
ItemFAM183B (FAM183BP) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335910
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetFAM183B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FAM183B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM183B. Synthetic peptide located within the following region: QTENQEIGWDSEALVDPERRDHRMNHFRVYSDITLYKAKMWSLGEDDRHK
NCBI Full Gene Namefamily with sequence similarity 183 member B, pseudogene
NCBI Gene AliasesFAM183B, THEG6
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!